Description

  • Product name

    Recombinant Human PPAP2A protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYK EDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK AIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEY YICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFF KERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
    • Amino acids

      1 to 284
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Lipid phosphate phosphohydrolase 1
    • Lipid phosphate phosphohydrolase 1a
    • LLP1a
    • LPP1
    • LPP1_HUMAN
    • PAP 2a
    • PAP-2a
    • PAP2
    • PAP2-alpha
    • PAP2a
    • PAP2a2
    • PAP2alpha2
    • PAPalpha1
    • Phosphatidate phosphohydrolase type 2a
    • Phosphatidic acid phosphatase 2a
    • Phosphatidic acid phosphatase type 2A
    • Phosphatidic acid phosphohydrolase type 2a
    • PPAP2A
    • Type 2 phosphatidic acid phosphatase alpha
    • Type 2 phosphatidic acid phosphohydrolase
    see all
  • Function

    Broad-specificity phosphohydrolase that dephosphorylates exogenous bioactive glycerolipids and sphingolipids. Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). Pivotal regulator of lysophosphatidic acid (LPA) signaling in the cardiovascular system. Major enzyme responsible of dephosphorylating LPA in platelets, which terminates signaling actions of LPA. May control circulating, and possibly also regulate localized, LPA levels resulting from platelet activation. It has little activity towards ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA > PA > S-1-P > C-1-P. It's down-regulation may contribute to the development of colon adenocarcinoma.
  • Tissue specificity

    Ubiquitously expressed with highest expression found in prostate. Isoform 1 is predominant in kidney, lung, placenta and liver. Isoform 2 is predominant in heart and pancreas. Found to be down-regulated in colon adenocarcinomas.
  • Sequence similarities

    Belongs to the PA-phosphatase related phosphoesterase family.
  • Post-translational
    modifications

    N-glycosylated. Contains high-mannose oligosaccharides.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab160110 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up