Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLS FYS
    • Amino acids
      114 to 166
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EC 3.1.3.4
    • Lipid phosphate phosphohydrolase 2
    • LPP2
    • PAP 2c
    • PAP2 G
    • PAP2 gamma
    • PAP2c
    • PAP2G
    • Phosphatidate phosphohydrolase type 2c
    • Phosphatidic acid phosphatase 2c
    • Phosphatidic acid phosphatase type 2C
    • Phosphatidic acid phosphohydrolase type 2c
    • Type 2 phosphatidic acid phosphatase gamma
    see all
  • Relevance
    PPAP2C belongs to the PA-phosphatase related phosphoesterase family. It catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is PA > C-1-P > LPA > S-1-P. PPAP2C is found mainly in brain, pancreas and placenta.
  • Cellular localization
    Membrane; Multi-pass membrane protein.

Images

  • ab160112 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up