Overview

  • Product name
    Recombinant Human PPCEL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQQKTKLFLQALKYSIPHLGKCMQKQHLNHYNFADHCYNRIKLKKYHLTK CLQNKPKISELARNIPSRSFSCKDLQPVKQENEKPLPENMDAFEKVRTKL ETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEADNDNYEVLFNLEE LKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIKLSDQPVMEASFP NVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDP SYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGVL YYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWDLFFTMKRNTKVI DLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSD PKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRLEAKS KDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKMNFRPERRVLVDD GWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQP SLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLT LEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPL KGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKIT AQIKFLYEELGLDSTSVFEDLKKYLKF
    • Amino acids
      1 to 727
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PPCEL_HUMAN
    • prepl
    • Prolyl endopeptidase-like
    • Prolylendopeptidase-like
    • putative prolyl oligopeptidase
    see all
  • Function
    Probable serine peptidase whose precise substrate specificity remains unclear. Does not cleave peptides after a arginine or lysine residue.
  • Tissue specificity
    Widely expressed. Expressed at higher level in brain, skeletal muscle, heart and kidney.
  • Involvement in disease
    Defects in PREPL are a cause of hypotonia-cystinuria syndrome (HCS) [MIM:606407]. HCS is characterized generalized hypotonia at birth, nephrolithiasis, growth hormone deficiency, minor facial dysmorphism, failure to thrive, followed by hyperphagia and rapid weight gain in late childhood. HCS is caused by a deletion that disrups both SLC3A1 and PREPL genes. As SLC3A1 is known to cause isolated cystinuria type I, the extended phenotype could be attributed to the deletion of PREPL.
  • Sequence similarities
    Belongs to the peptidase S9A family.
  • Cellular localization
    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • Lane 1 : Anti-PPCEL antibody [EPR17752] (ab203111) at 1/1000 dilution
    Lane 2 : Anti-GST antibody [EPR4236] (ab111947) at 1/10000 dilution

    All lanes : Recombinant Human PPCEL protein (ab160557)

    Lysates/proteins at 0.01 µg per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/20000 dilution

    Observed band size: 109 kDa
    why is the actual band size different from the predicted?



    Exposure time:

    Lane 1: 3 seconds.

    Lane 2: 3 minutes.

     

    Blocking and dilution buffer: 5% NFDM/TBST.

  • ab160557 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up