Description

  • Product name

    Recombinant Human PPCEL/PREPL protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQQKTKLFLQALKYSIPHLGKCMQKQHLNHYNFADHCYNRIKLKKYHLTK CLQNKPKISELARNIPSRSFSCKDLQPVKQENEKPLPENMDAFEKVRTKL ETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEADNDNYEVLFNLEE LKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIKLSDQPVMEASFP NVSSFEWVKDEEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDP SYFVFLYLTKDSRFLTINIMNKTTSEVWLIDGLSPWDPPVLIQKRIHGVL YYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWDLFFTMKRNTKVI DLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSD PKNCPFQLCSPIRPPKYYTYKFAEGKLFEETGHEDPITKTSRVLRLEAKS KDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKMNFRPERRVLVDD GWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQP SLTTLTAFSAGGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLT LEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPL KGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKIT AQIKFLYEELGLDSTSVFEDLKKYLKF
    • Amino acids

      1 to 727
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as PPCEL

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • PPCEL_HUMAN
    • prepl
    • Prolyl endopeptidase-like
    • Prolylendopeptidase-like
    • putative prolyl oligopeptidase
    see all
  • Function

    Probable serine peptidase whose precise substrate specificity remains unclear. Does not cleave peptides after a arginine or lysine residue.
  • Tissue specificity

    Widely expressed. Expressed at higher level in brain, skeletal muscle, heart and kidney.
  • Involvement in disease

    Defects in PREPL are a cause of hypotonia-cystinuria syndrome (HCS) [MIM:606407]. HCS is characterized generalized hypotonia at birth, nephrolithiasis, growth hormone deficiency, minor facial dysmorphism, failure to thrive, followed by hyperphagia and rapid weight gain in late childhood. HCS is caused by a deletion that disrups both SLC3A1 and PREPL genes. As SLC3A1 is known to cause isolated cystinuria type I, the extended phenotype could be attributed to the deletion of PREPL.
  • Sequence similarities

    Belongs to the peptidase S9A family.
  • Cellular localization

    Cytoplasm > cytosol.
  • Information by UniProt

Images

  • Lane 1 : Anti-PPCEL/PREPL antibody [EPR17752] (ab203111) at 1/1000 dilution
    Lane 2 : Anti-GST antibody [EPR4236] (ab111947) at 1/10000 dilution

    All lanes : Recombinant Human PPCEL/PREPL protein (ab160557)

    Lysates/proteins at 0.01 µg per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/20000 dilution

    Observed band size: 109 kDa
    why is the actual band size different from the predicted?



    Exposure time:

    Lane 1: 3 seconds.

    Lane 2: 3 minutes.

     

    Blocking and dilution buffer: 5% NFDM/TBST.

  • ab160557 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up