Description

  • Product name

    Recombinant Human PPCS protein
  • Purity

    > 95 % SDS-PAGE.
    Purified by using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAEMDPVAEFPQPPGAARWAEVMARFAARL GAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGV LFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAE ALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAA VSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISF KLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLL SEEEIEKGVEIEEKIVDNLQSRHTAFIGDRN
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      1 to 331
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • COAB
    • FLJ11838
    • MGC117357
    • MGC138220
    • OTTHUMP00000008433
    • Phosphopantothenate--cysteine ligase
    • Phosphopantothenoylcysteine synthetase
    • PPC synthetase
    • Ppcs
    • PPCS_HUMAN
    • RP11-163G10.1
    see all
  • Function

    Catalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.
  • Pathway

    Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 2/5.
  • Sequence similarities

    Belongs to the PPC synthetase family.
  • Information by UniProt

Images

  • ab107145 at 3 µg analysed by 15% SDS PAGE.

References

ab107145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab107145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up