Overview

  • Product name
    Recombinant Human PPFIA4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RQVMEREFNNLLALGTDRKLDDGDDKVFRRAPSWRKRFRPREHHGRGGML SASAETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAF
    • Amino acids
      604 to 699
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA0897
    • LIPA4_HUMAN
    • Liprin alpha 4
    • Liprin-alpha-4
    • PPFIA 4
    • PPFIA4
    • Protein tyrosine phosphatase receptor type f polypeptide (PTPRF) interacting protein (liprin) alpha 4
    • Protein tyrosine phosphatase receptor type f polypeptide interacting protein alpha 4
    • Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-4
    • PTPRF interacting protein alpha 4
    • PTPRF-interacting protein alpha-4
    see all
  • Function
    May regulate the disassembly of focal adhesions. May localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates.
  • Tissue specificity
    Expressed only in the heart, brain, and skeletal muscle.
  • Sequence similarities
    Belongs to the liprin family. Liprin-alpha subfamily.
    Contains 3 SAM (sterile alpha motif) domains.
  • Domain
    The N-terminal coiled coil regions mediate homodimerization preferentially and heterodimerization type alpha/alpha. The C-terminal, non-coiled coil regions mediate heterodimerization type alpha/beta and interaction with PTPRD, PTPRF and PTPRS.
  • Cellular localization
    Cytoplasm. Cell surface. Colocalizes with PTPRF at the cell surface.
  • Information by UniProt

Images

  • ab160054 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up