Description

  • Product name

    Recombinant Human PPIC protein
  • Purity

    > 95 % SDS-PAGE.
    Supplied as a 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEY QGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQL KEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPD LGTDDDDKAMAKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVEN FVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPD ENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDG MTVVHSIELQATD
    • Predicted molecular weight

      34 kDa
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 89% Phosphate Buffer, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • Cyclophilin C
    • CYPC
    • MGC3673
    • Parvulin
    • Peptidyl prolyl cis trans isomerase C
    • Peptidyl-prolyl cis-trans isomerase C
    • peptidylprolyl isomerase C
    • Peptidylprolyl isomerase C (cyclophilin C)
    • PPIase C
    • ppiC
    • PPIC_HUMAN
    • Rotamase C
    see all
  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities

    Belongs to the cyclophilin-type PPIase family.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab151358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up