Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKD VGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGD ITTGDGTGGVSIYGETFPDENFKL
    • Amino acids

      1 to 124
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cyclophilin C
    • CYPC
    • MGC3673
    • Parvulin
    • Peptidyl prolyl cis trans isomerase C
    • Peptidyl-prolyl cis-trans isomerase C
    • peptidylprolyl isomerase C
    • Peptidylprolyl isomerase C (cyclophilin C)
    • PPIase C
    • ppiC
    • PPIC_HUMAN
    • Rotamase C
    see all
  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities

    Belongs to the cyclophilin-type PPIase family.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab159167 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up