Recombinant human PPIH protein (ab78874)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human PPIH protein
See all PPIH proteins and peptides -
Biological activity
Specific activity is > 220nmol/min/mg, and is defined as the amount of enzyme that cleaves 1umole of suc-AAPF-pNA per minute at 37°C in Tris-Hcl pH8.0 using chymotrypsin.
-
Purity
> 95 % SDS-PAGE.
ab78874 is purified using conventional chromatography techniques. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE FRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENF KLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLV MRKIENVPTGPNNKPKLPVVISQCGEM
-
Specifications
Our Abpromise guarantee covers the use of ab78874 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: PBS, 10% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Cyclophilin H
- CYP-20
- CypH
see all -
Function
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. May act as a chaperone. -
Sequence similarities
Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.
Contains 1 PPIase cyclophilin-type domain. -
Cellular localization
Nucleus speckle. Cytoplasm. Colocalizes with spliceosomal snRNPs. A small proportion may also be cytoplasmic. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab78874 has not yet been referenced specifically in any publications.