Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNG TKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAM ANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQ DRPVDDVKIIKAYPSGLEHHHHHH

Specifications

Our Abpromise guarantee covers the use of ab79247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 300 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant PPIL1 protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1deg;C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab79247 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CGI 124
    • CGI-124
    • CGI124
    • Cyclophilin related gene 1
    • cyclophilin-related gene 1
    • cyclophilinrelated gene 1
    • CYPL1
    • hCyPX
    • MGC678
    • peptidyl-prolyl cis-trans isomerase
    • Peptidyl-prolyl cis-trans isomerase-like 1
    • Peptidylprolyl isomerase (cyclophilin) like 1
    • peptidylprolyl isomerase (cyclophilin)-like 1
    • peptidylprolyl isomerase (cyclophilin)like 1
    • peptidylprolyl isomerase (cyclophilin)like1
    • peptidylprolyl isomerase like 1
    • PPIase
    • PPIL1
    • PPIL1_HUMAN
    • rotamase
    • Rotamase PPIL1
    see all
  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.
  • Tissue specificity

    Ubiquitous, with the most abundant expression in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the cyclophilin-type PPIase family. PPIL1 subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab79247 at approximately 19kDa (3µg).

References

ab79247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab79247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up