Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGKRQHQKDKMYITCAEYTHFYGGKKPDLP QTNFRRLPFDHCSLSLQPFVYPVCTPDGIVFDLLNIVPWLKKYGTNPSNG EKLDGRSLIKLNFSKNSEGKYHCPVLFTVFTNNTHIVAVRTTGNVYAYEA VEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFYHVKNNMK IIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEK KKVDKLNAAHYSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKG YVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVI QGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQF FITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDA TTVFVDPYEEADAQIAQERKTQLKVAPETKVKSSQPQAGSQGPQTFRQGV GKYINPAATEQQRKSPQPVPLSPCPRRSPVGVLGTSAPGSSRLPDDH
    • Molecular weight
      62 kDa including tags
    • Amino acids
      1 to 527
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is > 290 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of Suc-AAFP-pNA per minute at 25°C in Tris-HCl pH 8.0 using chymotrypsin.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 80% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • FLJ39930
    • CYC4
    • Cyclophilin 60
    • Cyclophilin 60kDa
    • Cyclophilin like protein Cyp 60
    • Cyclophilin-60
    • Cyclophilin-like protein Cyp-60
    • CYP60
    • hCyP 60
    • MGC33174
    • MGC787
    • Peptidyl prolyl cis trans isomerase like 2
    • Peptidyl-prolyl cis-trans isomerase-like 2
    • Peptidylprolyl cis trans isomerase
    • Peptidylprolyl isomerase cyclophilin like 2
    • PPIase
    • PPIL2
    • PPIL2_HUMAN
    • Rotamase
    • Rotamase PPIL2
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity
    Highest expression in thymus, pancreas and testis. Also detected in heart, placenta, lung, liver, skeletal muscle, kidney, spleen, prostate, ovary, small intestine and colon. Poorly detected in brain and leukocytes. Strong protein expression in lymph node (cortical, paracortical and medullar regions), thyroid (follicular epithelial cells), testis (developing spermatozoa), stomach (cells lining the gastric pit), pancreas, kidney (proximal and distal-tubule cells and collecting duct cells but not in glomeruli), endometrium and colon (goblet cells). Moderate protein expression in spleen, prostate (epithelium and squamous cell carcinomas), placenta and adrenal gland. Weak protein expression in liver, heart, breast, ovary, and lung. No protein expression in brain and bladder. High protein expression in most lymphomas and melanomas.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIL2 subfamily.
    Contains 1 PPIase cyclophilin-type domain.
    Contains 1 U-box domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167969 (3µg).

References

ab167969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up