Description

  • Product name

    Recombinant Human PPOX protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPN GAIFELGPRGIRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLY VGGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFA QRRLGPEVASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHRSILLG LLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQALETHLTSRGVS VLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDS VAFPEQDGSPPGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQ LGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGAS YEGVAVNDCIESGRQAAVSVLGTEPNS
    • Amino acids

      1 to 477
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC8485
    • PPO
    • PPOX
    • PPOX_HUMAN
    • Protoporphyrinogen oxidase
    • V290M
    • Variegate porphyria
    • VP
    see all
  • Function

    Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Pathway

    Porphyrin metabolism; protoporphyrin-IX biosynthesis; protoporphyrin-IX from protoporphyrinogen-IX: step 1/1.
  • Involvement in disease

    Defects in PPOX are the cause of variegate porphyria (VP) [MIM:176200]. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. PV is the most common form of porphyria in South Africa. It is characterized by skin hyperpigmentation and hypertrichosis, abdominal pain, tachycardia, hypertension and neuromuscular disturbances. High fecal levels of protoporphyrin and coproporphyrin, increased urine uroporphyrins and iron overload are typical markers of the disease.
  • Sequence similarities

    Belongs to the protoporphyrinogen oxidase family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab159169 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159169 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up