Description

  • Product name

    Recombinant Human PPP1R14B/PNG protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPV RRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDEL LDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK
    • Amino acids

      1 to 147
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as PPP1R14B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • PHI 1
    • PHI1
    • Phospholipase C beta 3 neighboring gene protein
    • Phospholipase C beta 3 neighbouring gene protein
    • Phospholipase C-beta-3 neighbouring gene protein
    • PLCB3N
    • PNG
    • PP14B_HUMAN
    • Ppp1r14b
    • Protein phosphatase 1 regulatory (inhibitor) subunit 14B
    • Protein phosphatase 1 regulatory subunit 14B
    • SOM172
    see all
  • Function

    Inhibitor of PPP1CA. Has over 50-fold higher inhibitory activity when phosphorylated.
  • Tissue specificity

    Ubiquitous. Expressed at low levels.
  • Sequence similarities

    Belongs to the PP1 inhibitor family.
  • Post-translational
    modifications

    Phosphorylated primarily on Thr-57 by PKC (in vitro). An unknown Ser is also phosphorylated by PKC (in vitro).
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab161981 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up