Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGP GERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLA NEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTPLHAAATCGHL HLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSI EAARAVPELRMLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAAL LLEHRASLSAKDQDGWEPLHAAAYWGQVPLVELLVAHGADLNAKSLMDET PLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVR RVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPP EEDNPEVVRPHNGRVGGSPVRHLYSKRLDRSVSYQLSPLDSTTPHTLVHD KAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDTVTPQPDCGFR AGGDPPLLKLTAPAVEAPVERRPCCLLM
    • Amino acids
      1 to 528
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2900084E10Rik
    • Likley ortholog of mouse myosin phosphatase targeting subunit 3
    • MGC14333
    • Myosin phosphatase target subunit 3
    • Myosin phosphatase targeting subunit 3
    • Myosin phosphatase-targeting subunit 3
    • MYPT3
    • PP16A_HUMAN
    • PPP1R16A
    • Protein phosphatase 1 regulatory subunit 16A
    • Protein phosphatase 1, regulatory (inhibitor) subunit 16A
    • R75527
    see all
  • Function
    Inhibits protein phosphatase 1 activity toward phosphorylase, myosin light chain and myosin substrates.
  • Sequence similarities
    Contains 5 ANK repeats.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab164725 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up