Recombinant Human PPP1R3B protein (denatured) (ab171709)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMMAVDIEYRYNCMAPSLRQERFAFKIS PKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVK VFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNR LQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPC QYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRG KNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLG YEKLGPYY
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 285
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • FLJ14005
    • FLJ34675
    • GL
    • Hepatic glycogen targeting protein phosphatase 1 regulatory subunit GL
    • Hepatic glycogen targeting subunit G(L)
    • Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL
    • PP1 subunit R4
    • Ppp1r3b
    • PPP1R4
    • PPR3B_HUMAN
    • Protein phosphatase 1 regulatory (inhibitor) subunit 3B
    • Protein phosphatase 1 regulatory subunit 3B
    • Protein phosphatase 1 regulatory subunit 4
    • Protein phosphatase 1 subunit 4
    • Protein phosphatase 1 subunit GL
    • PTG
    • R4
    see all
  • Function
    Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.
  • Tissue specificity
    Highly expressed in liver. Expressed moderately in skeletal muscle and myotubes (at protein level). Expressed predominantly in heart and skeletal muscle. Expressed moderately in liver. Expressed weakly in placenta, lung and kidney.
  • Sequence similarities
    Contains 1 CBM21 (carbohydrate binding type-21) domain.
  • Domain
    The N-terminal region is required for binding to PP1, the central region is required for binding to glycogen and the C-terminal region is required for binding to PYGL.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171709 (3µg).

References

ab171709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up