Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSE LLPFLTDTIYDEDEVLLALAEQLGTFATLVGGPEYVHCLLPPLESLATVE ETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGL FSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDN VKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQ AAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIM GLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQL SQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAW LVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMT TLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPI LDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
    • Molecular weight

      91 kDa including tags
    • Amino acids

      1 to 589

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2AAA_HUMAN
    • 6330556D22Rik
    • Alpha isoform of regulatory subunit A, protein phosphatase
    • DKFZp470L0914
    • Medium tumor antigen-associated 61 kDa protein
    • MGC128399
    • MGC786
    • MGC83000
    • MGC95083
    • PP2A
    • PP2A Aalpha
    • PP2A subunit A isoform PR65-alpha
    • PP2A subunit A isoform R1-alpha
    • PP2A, subunit A, PR65-alpha isoform
    • PP2A, subunit A, R1-alpha isoform
    • PP2AAALPHA
    • Ppp2r1a
    • ppp2r1a-b
    • PR65
    • PR65-alpha
    • PR65A
    • Protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alpha isoform
    • Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform, isoform CRA_a
    • Protein phosphatase 2 (formerly 2A), regulatory subunit A,
    • Protein phosphatase 2 regulatory subunit A alpha
    • Protein phosphatase 2, 65-KD regulatory subunit A, alpha
    • Protein phosphatase 2, regulatory subunit A, alpha isoform
    • Protein phosphatase 2, structural/regulatory subunit A, alpha; PPP2R1A
    • Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
    see all
  • Function

    The PR65 subunit of protein phosphatase 2A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. Required for proper chromosome segregation and for centromeric localization of SGOL1 in mitosis.
  • Sequence similarities

    Belongs to the phosphatase 2A regulatory subunit A family.
    Contains 15 HEAT repeats.
  • Domain

    Each HEAT repeat appears to consist of two alpha helices joined by a hydrophilic region, the intrarepeat loop. The repeat units may be arranged laterally to form a rod-like structure.
  • Cellular localization

    Cytoplasm. Chromosome > centromere. Centromeric localization requires the presence of BUB1.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132198 stained with Coomassie Blue.

References

ab132198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up