Overview

  • Product name
    Recombinant Human PPP2R2A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGG RVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIR WLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVT TLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRI NLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGT IRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCW NGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCAS GKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN
    • Amino acids
      1 to 447
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2ABA_HUMAN
    • Alpha isoform of regulatory subunit B55 protein phosphatase 2
    • B55A
    • B55ALPHA
    • calcineurin
    • PP2A subunit B B alpha isoform
    • PP2A subunit B B55 alpha isoform
    • PP2A subunit B isoform alpha
    • PP2A subunit B isoform B55-alpha
    • PP2A subunit B isoform PR55-alpha
    • PP2A subunit B isoform R2-alpha
    • PP2A subunit B PR55 alpha isoform
    • PP2A subunit B R2 alpha isoform
    • PPP2R2A
    • PR52A
    • PR55A
    • Protein phosphatase 2 (formerly 2A) regulatory subunit B (PR 52) alpha isoform
    • Protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform
    • Protein phosphatase 2 regulatory subunit B alpha
    • Protein phosphatase 2 regulatory subunit B alpha isoform
    • Protein phosphatase 2 regulatory subunit Balpha
    • Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
    • Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
    • Testicular tissue protein Li 156
    see all
  • Function
    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Tissue specificity
    Expressed in all tissues examined.
  • Sequence similarities
    Belongs to the phosphatase 2A regulatory subunit B family.
    Contains 7 WD repeats.
  • Information by UniProt

Images

  • ab159172 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up