Overview

  • Product name
    Recombinant Human PPP2R2B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVI FQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQ QNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRV PVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWN FEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLC DMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSD SVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRR KDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN
    • Molecular weight
      74 kDa including tags
    • Amino acids
      1 to 443

Specifications

Our Abpromise guarantee covers the use of ab132644 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2ABB_HUMAN
    • B55 beta
    • Beta isoform of regulatory subunit B55 protein phosphatase 2
    • MGC24888
    • PP2A B55beta
    • PP2A PR55B
    • PP2A subunit B B beta isoform
    • PP2A subunit B B55 beta isoform
    • PP2A subunit B isoform B55 beta
    • PP2A subunit B isoform B55-beta
    • PP2A subunit B isoform beta
    • PP2A subunit B isoform PR55 beta
    • PP2A subunit B isoform PR55-beta
    • PP2A subunit B isoform R2 beta
    • PP2A subunit B isoform R2-beta
    • PP2A subunit B PR55 beta isoform
    • PP2A subunit B R2 beta isoform
    • Ppp2r2b
    • PR2AB beta
    • PR2AB55 beta
    • PR2APR55 beta
    • PR52B
    • PR55 beta
    • Protein phosphatase 2 (formerly 2A) regulatory subunit B (PR 52) beta isoform
    • Protein phosphatase 2 (formerly 2A) regulatory subunit B beta isoform
    • Protein phosphatase 2 regulatory subunit B
    • Protein phosphatase 2 regulatory subunit B beta isoform
    • SCA 12
    • SCA12
    • Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
    • Serine/threonine protein phosphatase 2A neuronal isoform
    • Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
    see all
  • Function
    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Within the PP2A holoenzyme complex, isoform 2 is required to promote proapoptotic activity (By similarity). Isoform 2 regulates neuronal survival through the mitochondrial fission and fusion balance.
  • Tissue specificity
    Brain.
  • Involvement in disease
    Defects in PPP2R2B are the cause of spinocerebellar ataxia type 12 (SCA12) [MIM:604326]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA12 is an autosomal dominant cerebellar ataxia (ADCA).
  • Sequence similarities
    Belongs to the phosphatase 2A regulatory subunit B family.
    Contains 7 WD repeats.
  • Domain
    The N-terminal 26 residues of isoform 2 constitute a cryptic mitochondrial matrix import signal with critical basic and hydrophobic residues, that is necessary and sufficient for targeting the PP2A holoenzyme to the outer mitochondrial membrane (OMM) and does not affect holoenzyme formation or catalytic activity.
    The last WD repeat of isoform 2 constitutes a mitochondrial stop-transfer domain that confers resistance to the unfolding step process required for import and therefore prevents PPP2R2B matrix translocation and signal sequence cleavage.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Membrane and Cytoplasm. Mitochondrion. Mitochondrion outer membrane. Under basal conditions, localizes to both cytosolic and mitochondrial compartments. Relocalizes from the cytosolic to the mitochondrial compartment during apoptosis. Its targeting to the outer mitochondrial membrane (OMM) involves an association with import receptors of the TOM complex and is required to promote proapoptotic activity.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132644 stained with Coomassie Blue.

References

ab132644 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132644.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up