Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQ AELHPLPQLKDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRAT LNELVEYVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEP TLEASWPHIQLVYEFFLRFLESPDFQPSIAKRYIDQKFVQQLLELFDSED PRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETEHFNGVAELL EILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEE PLFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLY KISKEHWNPTIVALVYNVLKTLMEMNGKLFDDLTSSYKAERQREKKKELE REELWKKLEELKLKKALEKQNSAYNMHSILSNTSAE
    • Amino acids
      1 to 486
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2A5A_HUMAN
    • B56A
    • MGC131915
    • PP2A B subunit B' alpha isoform
    • PP2A B subunit B56 alpha isoform
    • PP2A B subunit isoform B''-alpha
    • PP2A B subunit isoform B56-alpha
    • PP2A B subunit isoform PR61-alpha
    • PP2A B subunit isoform R5-alpha
    • PP2A B subunit PR61 alpha isoform
    • PP2A B subunit R5 alpha isoform
    • PPP2R5A
    • PR61A
    • PR61alpha
    • Protein phosphatase 2 regulatory subunit B (B56) alpha isoform
    • Protein phosphatase 2 regulatory subunit B' alpha
    • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
    see all
  • Function
    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Tissue specificity
    Widely expressed with the highest expression in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the phosphatase 2A regulatory subunit B56 family.
  • Post-translational
    modifications
    Phosphorylated on serine residues.
  • Cellular localization
    Cytoplasm. Nucleus. Chromosome > centromere. From mitotic prophase to metaphase, localizes at the inner centromere between a pair of sister kinetochores. Decreased expression at the onset of anaphase.
  • Information by UniProt

Images

  • ab159173 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up