Description

  • Product name

    Recombinant Human PPP2R5B protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQF RYQSNQQELTPLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGK EVKRAALNELVECVGSTRGVLIEPVYPDIIRMISVNIFRTLPPSENPEFD PEEDEPNLEPSWPHLQLVYEFFLRFLESPDFQPSVAKRYVDQKFVLMLLE LFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFLRFIYEFEHFN GVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQ FVKIQEPLFKQVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPA VFGTLYQVSKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQE QQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTPQVAASGGQS
    • Predicted molecular weight

      84 kDa
    • Amino acids

      1 to 497

Specifications

Our Abpromise guarantee covers the use of ab131823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2A5B_HUMAN
    • B56B
    • Beta isoform of regulatory subunit B56 protein phosphatase 2A
    • FLJ35411
    • PP2A B subunit B' beta isoform
    • PP2A B subunit B56 beta isoform
    • PP2A B subunit isoform B' beta
    • PP2A B subunit isoform B''-beta
    • PP2A B subunit isoform B56-beta
    • PP2A B subunit isoform PR61-beta
    • PP2A B subunit isoform R5-beta
    • PP2A B subunit PR61 beta isoform
    • PP2A B subunit R5 beta isoform
    • PPP2R5B
    • PR 61B
    • PR61B
    • Protein phosphatase 2 regulatory subunit B (B56) beta
    • Protein phosphatase 2 regulatory subunit B (B56) beta isoform
    • Protein phosphatase 2 regulatory subunit B' beta
    • Protein phosphatase 2 regulatory subunit B' beta isoform
    • Serine/threonine protein phosphatase 2A 56 kDa regulatory subunit beta isoform
    • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
    see all
  • Function

    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. The phosphorylated form mediates the interaction between AKT1 and PP2A phosphatase leading to dephosphorylation of AKT1 on the 'Thr-308' and 'Ser-373' residues.
  • Tissue specificity

    Highest expression in brain.
  • Sequence similarities

    Belongs to the phosphatase 2A regulatory subunit B56 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131823 stained with Coomassie Blue.

References

ab131823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up