Overview

  • Product name

    Recombinant Human PPP2R5C protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCC VLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA VNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDF QPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYI RKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKV LLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYW NNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEM NQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYTVYSQAS TMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDRPLARRKSELP QDPHTKKALEAHCRADELASQDGR
    • Molecular weight

      88 kDa including tags
    • Amino acids

      1 to 524

Specifications

Our Abpromise guarantee covers the use of ab131822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2A5G_HUMAN
    • B' alpha regulatory subunit
    • B56G
    • KIAA0044
    • MGC23064
    • PP2A B subunit B' gamma isoform
    • PP2A B subunit B56 gamma isoform
    • PP2A B subunit isoform B' gamma
    • PP2A B subunit isoform B''-gamma
    • PP2A B subunit isoform B56-gamma
    • PP2A B subunit isoform PR61-gamma
    • PP2A B subunit isoform R5-gamma
    • PP2A B subunit PR61 gamma isoform
    • PP2A B subunit R5 gamma isoform
    • Ppp2r5c
    • PR61G
    • Protein phosphatase 2 regulatory subunit B (B56) gamma isoform
    • Protein phosphatase 2 regulatory subunit B' gamma
    • Protein phosphatase 2, regulatory subunit B', gamma isoform
    • Renal carcinoma antigen NY REN 29
    • Renal carcinoma antigen NY-REN-29
    • Serine/threonine protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
    • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
    see all
  • Function

    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. The PP2A-PPP2R5C holoenzyme may specifically dephosphorylate and activate TP53 and play a role in DNA damage-induced inhibition of cell proliferation. PP2A-PPP2R5C may also regulate the ERK signaling pathway through ERK dephosphorylation.
  • Tissue specificity

    Highest levels in heart, skeletal muscle and brain. Lower levels in pancreas, kidney, lung and placenta. Very low levels in liver.
  • Sequence similarities

    Belongs to the phosphatase 2A regulatory subunit B56 family.
  • Post-translational
    modifications

    Isoform Gamma-3 is phosphorylated on serine residues. Isoform Gamma-1 phosphorylation by ERK2 is IER3-dependent and inhibits ERK dephosphorylation by PP2A-PPP2R5C.
  • Cellular localization

    Nucleus. Chromosome > centromere.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131822 at approximately 87.5 kDa.

References

ab131822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up