Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPL LKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYI TISRGCLTEQTYPEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPH LQLVYEFFIRFLESQEFQPSIAKKYIDQKFVLQLLELFDSEDPRERDYLK TVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAELLEILGSIIN GFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAK CVSSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWN PAIVALVYNVLKAFMEMNSTMFDELTATYKSDRQREKKKEKEREELWKKL EDLELKRGLRRDGIIPT
    • Molecular weight

      81 kDa including tags
    • Amino acids

      1 to 467

Specifications

Our Abpromise guarantee covers the use of ab131817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2A5E_HUMAN
    • Epsilon isoform of regulatory subunit B56 protein phosphatase 2A
    • PP2A B subunit B' epsilon
    • PP2A B subunit B' epsilon isoform
    • PP2A B subunit B56 epsilon
    • PP2A B subunit B56 epsilon isoform
    • PP2A B subunit isoform B''-epsilon
    • PP2A B subunit isoform B'-epsilon
    • PP2A B subunit isoform B56-epsilon
    • PP2A B subunit isoform PR61-epsilon
    • PP2A B subunit isoform R5-epsilon
    • PP2A B subunit PR61 epsilon
    • PP2A B subunit PR61 epsilon isoform
    • PP2A B subunit R5 epsilon
    • PP2A B subunit R5 epsilon isoform
    • PPP2R5E
    • Protein phosphatase 2 regulatory subunit B (B56) epsilon isoform
    • Protein phosphatase 2 regulatory subunit B' epsilon
    • Protein phosphatase 2 regulatory subunit B' epsilon isoform
    • Regulatory subunit B of protein phosphatase 2 epsilon isoform
    • Serine/threonine protein phosphatase 2A 56 kDa regulatory subunit epsilon
    • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
    see all
  • Function

    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Sequence similarities

    Belongs to the phosphatase 2A regulatory subunit B56 family.
  • Post-translational
    modifications

    Phosphorylated on serine residues.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131817 at approximately 81.1 kDa.

References

ab131817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up