Overview

  • Product name

    Recombinant Human PPP3CB protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKG LDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
    • Amino acids

      435 to 524
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Calcineurin A beta
    • Calcineurin A2
    • Calcineurin B, formerly
    • Calmodulin dependent calcineurin A subunit beta isoform
    • Calmodulin-dependent calcineurin A subunit beta isoform
    • CALNA 2
    • CALNA2
    • CALNB
    • CAM PRP catalytic subunit
    • CAM-PRP catalytic subunit
    • CNA2
    • CnAbeta
    • PP2BB_HUMAN
    • PP2Bbeta
    • PPP3CB
    • Protein phosphatase 2B, catalytic subunit, beta isoform, formerly
    • Protein phosphatase 3 (formerly 2B) catalytic subunit beta isoform
    • Protein phosphatase 3 catalytic subunit beta isoform
    • Protein phosphatase 3 catalytic subunit beta isozyme
    • Serine/threonine protein phosphatase 2B catalytic subunit beta isoform
    • Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
    see all
  • Function

    Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
  • Sequence similarities

    Belongs to the PPP phosphatase family. PP-2B subfamily.
  • Information by UniProt

Images

  • ab159176 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up