Overview

  • Product name

    Recombinant Human PPP3CC protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEG RLEEEVALKIINDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEV GGSPSNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECR HLTDYFTFKQECRIKYSEQVYDACMETFDCLPLAALLNQQFLCVHGGMSP EITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTHNTVR GCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSL PFVGEKVTEMLVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKM ARVFSILRQESESVLTLKGLTPTGTLPLGVLSGGKQTIETATVEAVEARE AIRGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHA AHRSDQGKKAHS
    • Amino acids

      1 to 512
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Calcineurin
    • calcineurin A gamma
    • CALCINEURIN A3
    • Calcineurin testis specific catalytic subunit
    • Calmodulin dependent calcineurin A subunit gamma isoform
    • Calmodulin-dependent calcineurin A subunit gamma isoform
    • CALNA3
    • CAM PRP catalytic subunit
    • CAM-PRP catalytic subunit
    • CNA3
    • pp2b gamma Antibody
    • PP2BC_HUMAN
    • PP2Bgamma Antibody
    • PPP3CC
    • protein phosphatase 3 (formerly 2B) catalytic subunit gamma isoform
    • protein phosphatase 3 (formerly 2B) catalytic subunit gamma isoform (calcineurin A gamma)
    • Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
    • testis-specific catalytic subunit
    see all
  • Function

    Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
  • Tissue specificity

    Testis.
  • Sequence similarities

    Belongs to the PPP phosphatase family. PP-2B subfamily.
  • Information by UniProt

Images

  • ab159177 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up