Description

  • Product name

    Recombinant Human PPT1/PPT protein
    See all PPT1/PPT proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab191922 is supplied as a 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLM EDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQR CPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQ ERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVM VKFLNDSIVDPVDSEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNA GQLVFLATEGDHLQLSEEWFYAHIIPFLGVDHHHHHH
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      28 to 306
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 28 to 306. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as PPT1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 10% Glycerol, 0.87% Sodium chloride, 0.32% Tris HCl

General Info

  • Alternative names

    • Ceroid palmitoyl palmitoyl protein thioesterase 1
    • CLN1
    • EC 3.1.2.22
    • INCL
    • Palmitoyl protein hydrolase 1
    • Palmitoyl protein thioesterase 1
    • Palmitoyl-protein hydrolase 1
    • Palmitoyl-protein thioesterase 1
    • PPT
    • PPT-1
    • PPT1
    • PPT1_HUMAN
    see all
  • Function

    Removes thioester-linked fatty acyl groups such as palmitate from modified cysteine residues in proteins or peptides during lysosomal degradation. Prefers acyl chain lengths of 14 to 18 carbons.
  • Involvement in disease

    Defects in PPT1 are the cause of neuronal ceroid lipofuscinosis type 1 (CLN1) [MIM:256730]. A form of neuronal ceroid lipofuscinosis with variable age at onset. Infantile, late-infantile, juvenile, and adult onset have been reported. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material, and clinically by seizures, dementia, visual loss, and/or cerebral atrophy. The lipopigment pattern seen most often in CLN1 is referred to as granular osmiophilic deposits (GROD).
  • Sequence similarities

    Belongs to the palmitoyl-protein thioesterase family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

References

ab191922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up