Recombinant Human PRADC1 protein (ab164551)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAK DFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSK TRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGY MIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW
    • Amino acids
      1 to 188
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C2orf7
    • hPAP21
    • MGC13004
    • PADC1_HUMAN
    • PAP21
    • Pradc1
    • Protease associated domain containing 1
    • Protease-associated domain-containing protein 1
    • Protease-associated domain-containing protein of 21 kDa
    see all
  • Tissue specificity
    Highly expressed in skeletal muscle, heart and liver. Expressed at intermediate level in kidney.
  • Sequence similarities
    Contains 1 PA (protease associated) domain.
  • Post-translational
    modifications
    N-glycosylated; required for efficient secretion.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab164551 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up