Description

  • Product name

    Recombinant Human PRAGMIN/SGK223 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRA GSLPPPPRLPPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTE
    • Amino acids

      2 to 101
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as PRAGMIN

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • D8Ertd82e
    • DKFZp761P0423
    • DNA segment, Chr 8, ERATO Doi 82
    • EC 2.7.10.2
    • Homolog of rat pragma of Rnd2
    • LOC157285
    • PRAGMIN
    • SG223_HUMAN
    • Sgk223
    • Sugen kinase 223
    • Tyrosine protein kinase SgK223
    • Tyrosine-protein kinase SgK223
    see all
  • Sequence similarities

    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab165686 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165686 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up