Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFAL KILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLI VMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLK PENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRR HQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTI PKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLK PLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQC ILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDR LKLAEIVKQVIEEQTTSHESQ
    • Amino acids

      1 to 471
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160089 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as PRAK

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MAP kinase-activated protein kinase 5
    • MAPK-activated protein kinase 5
    • MAPK5_HUMAN
    • MAPKAP kinase 5
    • MAPKAPK-5
    • MAPKAPK5
    • Mitogen activated protein kinase activated protein kinase 5
    • p38-regulated/activated protein kinase
    • PRAK
    see all
  • Function

    Mediates stress-induced small heat shock protein 27 phosphorylation.
  • Tissue specificity

    Expressed ubiquitously.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated on Thr-182; which is the regulatory phosphorylation site and is located on the T-loop/loop 12.
  • Cellular localization

    Cytoplasm. Nucleus. Also observed in the nucleus.
  • Information by UniProt

Images

  • ab160089 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160089 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160089.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up