Description

  • Product name

    Recombinant Human PRAME protein
    See all PRAME proteins and peptides
  • Purity

    > 98 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQ ALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
    • Predicted molecular weight

      11 kDa
    • Amino acids

      321 to 420

Specifications

Our Abpromise guarantee covers the use of ab181886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Sandwich ELISA

    SDS-PAGE

    Western blot

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.121% Tris, 0.35% Sodium phosphate

  • Reconstitution
    Reconstitute in water to a concentration of 0.1 mg/ml. This may then be diluted further into water or other buffer solutions.

General Info

  • Alternative names

    • 4930534P07Rik
    • Cancer/testis antigen 130
    • CT130
    • MAPE
    • Melanoma antigen preferentially expressed in tumors
    • OIP 4
    • OIP-4
    • OIP4
    • OPA interacting protein 4
    • Opa interacting protein OIP4
    • OPA-interacting protein 4
    • PRAME
    • PRAME_HUMAN
    • Preferentially expressed antigen in melanoma
    • Preferentially expressed antigen of melanoma
    • RP23-250F8.3
    see all
  • Function

    Functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. Prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.
  • Tissue specificity

    Expressed in testis. Detected in samples of kidney, brain and skin.
  • Sequence similarities

    Belongs to the PRAME family.
    Contains 4 LRR (leucine-rich) repeats.
  • Cellular localization

    Nucleus. Cell membrane.
  • Information by UniProt

Images

  • Sandwich ELISA using ab181886 as standard.

  • 15% SDS PAGE analysis of ab181886 under reducing conditions, stained with Coomassie blue.

References

ab181886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up