Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWK KNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLP FGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSG PHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWIS ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQA LNVYYNYSGQVKCLNISETATSSLGTLGWSYQACTEVVMPFCTNGVDDMF EPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHTNIVFSNGELD PWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH MKNWIRDFYDSAGKQH
    • Molecular weight

      53 kDa including tags
    • Amino acids

      31 to 496
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 31 to 496. The signal peptide is not included. GenBank Accession #NM_005040.

Specifications

Our Abpromise guarantee covers the use of ab198658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    = 50 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.36% Imidazole
    Constituents: 0.48% Tris, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT

General Info

  • Alternative names

    • Angiotensinase C
    • HUMPCP
    • Lysosomal carboxypeptidase C
    • Lysosomal Pro X carboxypeptidase
    • Lysosomal Pro-X carboxypeptidase
    • MGC2202
    • PCP
    • PCP_HUMAN
    • PRCP
    • Proline carboxypeptidase
    • Prolylcarboxypeptidase
    • Prolylcarboxypeptidase (angiotensinase C)
    • prolylcarboxypeptidase isoform 1 preproprotein
    see all
  • Function

    Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.
  • Tissue specificity

    Highest levels in placenta, lung and liver. Also present in heart, brain, pancreas and kidney.
  • Sequence similarities

    Belongs to the peptidase S28 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • 10% SDS-Page analysis of ab198658 (1 μg)

References

ab198658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up