Description

  • Product name

    Recombinant Human PRD protein
    See all PRD proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab202165 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAAATGPSFWLGNETLKVPLALFALNR QRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAFGV TEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQ YVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILH PEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFE HYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDM GGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWP DMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVH DVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALA DPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEA CMAGCDKAFTPFSGPK
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      1 to 493
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000276.

Specifications

Our Abpromise guarantee covers the use of ab202165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as PEPD

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • Aminoacyl L proline hydrolase
    • Imidodipeptidase
    • MGC10905
    • MGC95081
    • Pep 4
    • Pep4
    • pepD
    • PEPD_HUMAN
    • Peptidase 4
    • Peptidase D
    • Prolidase
    • Proline dipeptidase
    • X pro dipeptidase
    • X-Pro dipeptidase
    • Xaa-Pro dipeptidase
    see all
  • Function

    Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen.
  • Involvement in disease

    Defects in PEPD are a cause of prolidase deficiency (PD) [MIM:170100]. Prolidase deficiency is an autosomal recessive disorder associated with iminodipeptiduria. The clinical phenotype includes skin ulcers, mental retardation, recurrent infections, and a characteristic facies. These features, however are incompletely penetrant and highly variable in both age of onset and severity. There is a tight linkage between the polymorphisms of prolidase and the myotonic dystrophy trait.
  • Sequence similarities

    Belongs to the peptidase M24B family. Eukaryotic-type prolidase subfamily.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab202165.

References

ab202165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up