Description

  • Product name

    Recombinant Human PRDM14 protein
    See all PRDM14 proteins and peptides
  • Purity

    >= 70 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQ^GPLGSALPRPSEAVPQDKVCYPP ESSPQNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEAAASAAPAMPPF PFRMAPPLLSPGLGLQREPLYDLPWYSKLPPWYPIPHVPREVPPFLSSSH EYAGASSEDLGHQIIGGDNESGPCCGPDTLIPPPPADASLLPEGLRTSQL LPCSPSKQSEDGPKPSNQEGKSPARFQFTEEDLHFVLYGVTPSLEHPASL HHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQTVFGEVPHFGVF CSSFIAKGVRFGPFQGKVVNASEVKTYGDNSVMWEIFEDGHLSHFIDGKG GTGNWMSYVNCARFPKEQNLVAVQCQGHIFYESCKEIHQNQELLVWYGDC YEKFLDIPVSLQVTEPGKQPSGPSEESAEGYRCERCGKVFTYK
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      2 to 412
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • MGC59730
    • PFM 11
    • PFM11
    • PR domain containing 14
    • PR domain zinc finger protein 14
    • PR domain-containing protein 14
    • PRD14_HUMAN
    • PRDM 14
    • PRDM14
    see all
  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Contains 6 C2H2-type zinc fingers.
    Contains 1 SET domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE with Coomassie staining: 2 µg ab196396.

References

This product has been referenced in:

  • Moriya C  et al. PRDM14 directly interacts with heat shock proteins HSP90a and glucose-regulated protein 78. Cancer Sci 109:373-383 (2018). Read more (PubMed: 29178343) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up