Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLS RRLLTKTNRMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNI
    • Amino acids

      3 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PX19.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 25 kDa protein of relevant evolutionary and lymphoid interest
    • CGI 106
    • MGC87972
    • mitochondrial
    • PRELI
    • PRELI domain containing 1
    • PRELI domain containing protein 1
    • PRELI domain containing protein 1 mitochondrial
    • PRELI domain-containing protein 1
    • PRELID 1
    • PRELID1
    • PRLD1_HUMAN
    • Protein of relevant evolutionary and lymphoid interest
    • PX 19
    • PX19
    • Px19 like protein
    • Px19, chicken, homolog of
    • Px19-like protein
    • SBBI12
    see all
  • Function

    May be important for the development of vital and immunocompetent organs.
  • Tissue specificity

    Highly expressed in fetal liver; less expressed in fetal brain, lung, and kidney. At the adult stage, expression is drastically reduced in the liver but highly expressed in the spleen, brain, lung, lymph nodes and peripheral blood leukocytes.
  • Sequence similarities

    Contains 1 PRELI/MSF1 domain.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab162107 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up