Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPD EPAEPTDLPPPLPPGPPSIFPDCPRECYCPPDFPSALYCDSRNLRKVPVI PPRIHYLYLQNNFITELPVESFQNATGLRWINLDNNRIRKIDQRVLEKLP GLVFLYMEKNQLEEVPSALPRNLEQLRLSQNHISRIPPGVFSKLENLLLL DLQHNRLSDGVFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLD SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH NRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVP HLRYLRLDGNYLKPPIPLDLMMCFRLLQSVVI
    • Molecular weight

      70 kDa including tags
    • Amino acids

      1 to 382

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Reduced glutathione

General Info

  • Alternative names

    • 55 kDa leucine rich repeat protein of articular cartilage
    • MST161
    • MSTP161
    • Prelp
    • PRELP_HUMAN
    • Prolargin
    • Prolargin proteoglycan
    • Proline arginine rich end leucine rich repeat protein
    • Proline-arginine-rich end leucine-rich repeat protein
    • Proline/arginine rich end leucine rich repeat protein
    • SLRR2A
    see all
  • Function

    May anchor basement membranes to the underlying connective tissue.
  • Tissue specificity

    Connective tissue.
  • Sequence similarities

    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.
    Contains 12 LRR (leucine-rich) repeats.
  • Domain

    The basic amino-terminal Arg/Pro-rich binds heparin and heparan sulfate. Binds collagens type I and type II through its leucine-rich repeat domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132856 stained with Coomassie Blue.

References

ab132856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up