Description

  • Product name

    Recombinant Human PRKACG protein
    See all PRKACG proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTL GMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAID
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as PKA gamma (catalytic subunit)

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • cAMP-dependent protein kinase catalytic subunit gamma
    • KAPCG_HUMAN
    • KAPG
    • PKA C gamma
    • PKA C-gamma
    • PKACg
    • PRKACG
    • Protein kinase cAMP dependent catalytic gamma
    • Serine (threonine) protein kinase
    see all
  • Function

    Phosphorylates a large number of substrates in the cytoplasm and the nucleus.
  • Tissue specificity

    Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab159193 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up