Recombinant Human PRKCBP1 protein (ab161715)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DEQKSKNEPEDTEDKEGCQMDKEPSAVKKKPKPTNPVEIKEELKSTSPAS EKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDETDSPTVHL
    • Amino acids
      601 to 698
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161715 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CTCL tumor antigen se14 3
    • Cutaneous T cell lymphoma associated antigen se14 3
    • KIAA1125
    • MGC31836
    • predicted protein of HQ2893
    • PRKCBP 1
    • PRO2893
    • Protein kinase C binding protein 1
    • Rack7
    • Zinc finger MYND domain containing protein 8
    • ZMYND 8
    • ZMYND8
    see all
  • Relevance
    PRKCBP1 (protein kinase C binding protein 1) is a receptor for activated C-kinase (RACK) protein. It has been shown to bind in vitro to activated protein kinase C beta I and is also a cutaneous T-cell lymphoma-associated antigen. PRKCBP1 contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene.
  • Cellular localization
    Nuclear

Images

  • ab161715 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161715 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161715.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up