Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFAAAEAANCIMENFVATLANGM SLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVR TLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSI SDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYES MLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGF DMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFC LQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDY LTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR
    • Molecular weight

      46 kDa including tags
    • Amino acids

      1 to 361
    • Additional sequence information

      With a small T7-His-TEV cleavage site Tag (29 aa) fusion at its N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab216183 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, sucrose and DTT.

General Info

  • Alternative names

    • ANM 1
    • ANM1
    • ANM1_HUMAN
    • HCP 1
    • HCP1
    • Heterogeneous nuclear ribonucleoprotein methyltransferase 1 like 2
    • Heterogeneous nuclear ribonucleoproteins methyltransferase like 2
    • Heterogeneous nuclear ribonucleoproteins methyltransferase like2
    • Histone-arginine N-methyltransferase PRMT1
    • HMT 2
    • HMT1 (hnRNP methyltransferase S. cerevisiae) like 2
    • HMT1 hnRNP methyltransferase
    • HMT1 hnRNP methyltransferase like 2
    • HMT1 hnRNP methyltransferase like 2 (S. cerevisiae)
    • HMT2
    • HRMT1 L2
    • HRMT1L 2
    • HRMT1L2
    • Human mRNA for suppressor for yeast mutant
    • Human mRNA for suppressor for yeast mutant complete cds
    • Interferon receptor 1 bound protein 4
    • Interferon receptor 1 bound protein4
    • Interferon receptor 1-bound protein 4
    • Interferon receptor 1bound protein 4
    • IR1 B4
    • IR1B 4
    • IR1B4
    • Mrmt 1
    • Mrmt1
    • PRMT 1
    • PRMT1
    • Protein arginine methyltransferase 1
    • Protein arginine N methyltransferase 1
    • Protein arginine N methyltransferase1
    • Protein arginine N-methyltransferase 1
    • R1B4
    • S. cerevisiae like 2
    see all
  • Function

    Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, PIAS1, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15 and EWS. Constitutes the main enzyme that mediates monomethylation and asymmetric dimethylation of histone H4 'Arg-4' (H4R3me1 and H4R3me2a, respectively), a specific tag for epigenetic transcriptional activation. Together with dimethylated PIAS1, represses STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling. May be involved in the regulation of TAF15 transcriptional activity, act as an activator of estrogen receptor (ER)-mediated transactivation, play a key role in neurite outgrowth and act as a negative regulator of megakaryocytic differentiation, by modulating p38 MAPK pathway.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the protein arginine N-methyltransferase family.
  • Cellular localization

    Nucleus. Cytoplasm > cytosol.
  • Information by UniProt

References

ab216183 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216183.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up