Overview

  • Product name

    Recombinant Human PRMT2/HMT1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLS FLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDE EYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGI ISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVV LPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLV PCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCL SEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSL QEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPV WRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
    • Molecular weight

      75 kDa including tags
    • Amino acids

      1 to 433

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

     This product was previously labelled as PRMT2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ANM2_HUMAN
    • EC 2.1.1.
    • histone arginine N methyltransferase PRMT2
    • Histone-arginine N-methyltransferase PRMT2
    • HMT 1
    • HMT1
    • HMT1 (hnRNP methyltransferase S. cerevisiae) like 1
    • HMT1 hnRNP methyltransferase like 1
    • hnRNP methyltransferase (S. cerevisiae) like 1
    • hnRNP methyltransferase like 1
    • Hrmt1l1
    • MGC111373
    • PRMT 2
    • prmt2
    • PRMT2 alpha
    • PRMT2 beta
    • PRMT2 gamma
    • PRMT2 protein
    • PRMT2L2
    • Protein arginine methyltransferase 2
    • Protein arginine N methyltransferase 2
    • Protein arginine N-methyltransferase 2
    • Zf2
    see all
  • Function

    Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.
  • Tissue specificity

    Widely expressed. Highly expressed in androgen target organs such as heart, prostate, skeletal muscle, ovary and spinal cord.
  • Sequence similarities

    Belongs to the protein arginine N-methyltransferase family.
    Contains 1 SH3 domain.
  • Cellular localization

    Cytoplasm. Nucleus. Translocates from the cytoplasm to the nucleus, after hormone exposure.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131909 stained with Coomassie Blue.

References

ab131909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up