Description

  • Product name

    Recombinant human PRMT3 protein
  • Biological activity

    The specific activity of ab167953 was determined to be 12 nmol/min/mg as per activity assay protocol.
  • Purity

    > 90 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPC LFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKN PTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPN GLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVR TCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQN PHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLN KLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAK NKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAV IPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMC TAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEA LKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGLQ
    • Predicted molecular weight

      97 kDa including tags
    • Amino acids

      1 to 531
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab167953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.004% EDTA, 25% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 2010005E20Rik
    • 2410018A17Rik
    • AL033309
    • ANM3_HUMAN
    • Heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 3
    • Heterogeneous nuclear ribonucleoprotein methyltransferase like 3
    • Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 3
    • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3
    • HMT1 hnRNP methyltransferase like 3
    • HMT1 hnRNP methyltransferase like 3 S. cerevisiae
    • HMT1-like 3
    • hnRNP methyltransferase like 3
    • HRMT1L3
    • PRMT 3
    • PRMT3
    • Protein arginine methyltransferase 3
    • Protein arginine N methyltransferase 3
    • Protein arginine N-methyltransferase 3
    see all
  • Function

    Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.
  • Sequence similarities

    Belongs to the protein arginine N-methyltransferase family.
    Contains 1 C2H2-type zinc finger.
  • Domain

    The zinc-finger is responsible for substrate specificity.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • The specific activity of ab167953 was determined to be 12 nmol/min/mg as per activity assay protocol.
  • SDS-PAGE analysis of ab167953.

References

This product has been referenced in:

  • Hsu MC  et al. Protein Arginine Methyltransferase 3 Enhances Chemoresistance in Pancreatic Cancer by Methylating hnRNPA1 to Increase ABCG2 Expression. Cancers (Basel) 11:N/A (2018). Read more (PubMed: 30577570) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up