Recombinant human PRMT5 + MEP50 protein (ab198151)

Description

  • Product name

    Recombinant human PRMT5 + MEP50 protein
  • Biological activity

    Assay Conditions:

    50 µl reaction mix (20 mM phosphate buffer pH 7.4, 20 µM S-adenosyl methionine, and 10-100 ng methyltransferase PRMT5) add to the wells coated with the substrate. Incubate at room temperature for 1 hr. Add antibody against methylated R3 residue of histone H4, incubate 1 hr. Add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminesence.

  • Purity

    >= 75 % SDS-PAGE.

  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      AAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFK REFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRR NSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMF WMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKR IAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQ RLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFA KGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPE EEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTL ENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLD GAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMP YVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGF AGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVR FWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      2 to 637
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      NM_006109, expressed in FreeStyle 293-F cells.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      RKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSG RCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSG AVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKV WDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPK PASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSS AVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVR DATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      2 to 342
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_024102, expressed in FreeStyle 293-F cells.

Specifications

Our Abpromise guarantee covers the use of ab198151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Expressed in FreeStyle 293-F cells.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.05% DTT, 0.02% Potassium chloride, 20% Glycerol

    80µg/ml DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • 10% SDS-PAGE analysis of ab198151 (5μg).

  • Specific activity of ab198151.

References

ab198151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up