Recombinant human PRMT6 protein (ab196434)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant human PRMT6 protein -
Biological activity
Specific Activity 0.015 pmol/min/µg
Assay Conditions: 50 µl reaction mix (20 mM phosphate buffer pH 7.4, 20 µM S-adenosylmethionine, and 1-5 ng methyltransferase PRMT6) is added to microwells coated with histone substrate. Incubate at 30°C for 2 hr. Add antibody against methylated Arg residue of histone H3, incubate 1 hr. Then, add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminesence. -
Purity
>= 45 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECY SDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCA QAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDA IVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQML EWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQ RFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGES EKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPR RLRVLLRYKVGDQEEKTKDFAMED -
Predicted molecular weight
43 kDa including tags -
Amino acids
2 to 375 -
Tags
His tag N-Terminus -
Additional sequence information
Genbank accession no.: NM_018137
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab196434 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.0
Preservative: 1.36% Imidazole
Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% GlycerolThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- ANM6_HUMAN
- Chromobox protein homolog 7
- FLJ10559
see all -
Function
Arginine methyltransferase that can catalyze the formation of both omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA), with a strong preference for the formation of aDMA. Preferentially methylates arginyl residues present in a glycine and arginine-rich domain and displays preference for monomethylated substrates. Specifically mediates the asymmetric dimethylation of histone H3 'Arg-2' to form H3R2me2a. H3R2me2a represents a specific tag for epigenetic transcriptional repression and is mutually exclusive with methylation on histone H3 'Lys-4' (H3K4me2 and H3K4me3). Acts as a transcriptional repressor of various genes such as HOXA2, THBS1 and TP53. Repression of TP53 blocks cellular senescence (By similarity). Also methylates histone H2A and H4 'Arg-3' (H2AR3me and H4R3me, respectively). Acts as a regulator of DNA base excision during DNA repair by mediating the methylation of DNA polymerase beta (POLB), leading to the stimulation of its polymerase activity by enhancing DNA binding and processivity. Methylates HMGA1. Regulates alternative splicing events. Acts as a transcriptional coactivator of a number of steroid hormone receptors including ESR1, ESR2, PGR and NR3C1. Promotes fasting-induced transcriptional activation of the gluconeogenic program through methylation of the CRTC2 transcription coactivator. May play a role in innate immunity against HIV-1 in case of infection by methylating and impairing the function of various HIV-1 proteins such as Tat, Rev and Nucleocapsid protein p7 (NC). -
Tissue specificity
Highly expressed in kidney and testis. -
Sequence similarities
Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N-methyltransferase family. PRMT6 subfamily.
Contains 1 SAM-dependent MTase PRMT-type domain. -
Post-translational
modificationsAutomethylation enhances its stability and antiretroviral activity. -
Cellular localization
Nucleus. - Information by UniProt
Images
-
SDS-PAGE analysis of 3 μg of ab196434 on a 10% SDS-PAGE gel stained with Coomassie.
-
SDS-PAGE analysis of 2 μg of ab196434 on a 4-20% SDS-PAGE gel stained with Coomassie.
-
Specific activity of ab196434.
Datasheets and documents
References
ab196434 has not yet been referenced specifically in any publications.