Description

  • Product name

    Recombinant human PRMT8 protein
    See all PRMT8 proteins and peptides
  • Biological activity

    Specific activity: 2.22 pmol/min/µg.

  • Purity

    >= 92 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVF KDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDN IITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKP GGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLV DIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTY FNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      61 to 394
    • Tags

      His-DDDDK tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab196394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

    80 µg/mL FLAG peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ANM8_HUMAN
    • Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 4
    • Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4
    • HMT1 hnRNP methyltransferase like 3
    • HMT1 hnRNP methyltransferase like 4
    • HRMT1 L3
    • HRMT1 L4
    • HRMT1L 3
    • HRMT1L 4
    • HRMT1L3
    • HRMT1L4
    • prmt8
    • Protein arginine N methyltransferase 4
    • Protein arginine N methyltransferase 8
    • Protein arginine N-methyltransferase 8
    see all
  • Function

    Membrane-associated arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA). Able to mono- and dimethylate EWS protein; however its precise role toward EWS remains unclear as it still interacts with fully methylated EWS.
  • Tissue specificity

    Brain-specific.
  • Sequence similarities

    Belongs to the protein arginine N-methyltransferase family. PRMT8 subfamily.
  • Domain

    The SH3-binding motifs mediate the interaction with SH3 domain-containing proteins such as PRMT2 and FYN, possibly leading to displace the N-terminal domain and activate the protein.
    The N-terminal region (1-60) inhibits the enzymatic activity.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 10% SDS PAGE with Coomassie staining: 4 µg ab196394.

  • Example of specific activity of ab196394. 

References

ab196394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up