Bioactive grade

Recombinant human Pro-neuregulin-1, membrane-bound isoform protein (ab222366)

Description

  • Product name

    Recombinant human Pro-neuregulin-1, membrane-bound isoform protein
  • Biological activity

    The activity can be determined by the ability to stimulate proliferation of MC7 cells under serum free conditions and is typically less than 0.3 ng/ml. There is no biological assay data available at this time.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYV MASFYKHLGIEFMEAE
    • Predicted molecular weight

      8 kDa
    • Amino acids

      177 to 241

Specifications

Our Abpromise guarantee covers the use of ab222366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting sterile deionized water down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.

General Info

  • Alternative names

    • Acetylcholine receptor-inducing activity
    • Acetylcholine receptor-inducing activity, chick, homolog of
    • ARIA
    • Breast cancer cell differentiation factor p45
    • GGF
    • GGF2
    • Glial growth factor
    • glial growth factor 2
    • Heregulin
    • heregulin, alpha
    • heregulin, alpha (45kD, ERBB2 p185-activator)
    • HGL
    • HRG
    • HRG1
    • HRGA
    • MST131
    • MSTP131
    • NDF
    • Neu differentiation factor
    • Neuregulin-1
    • nrg1
    • NRG1-IT2
    • NRG1_HUMAN
    • Pro-NRG1
    • Sensory and motor neuron-derived factor
    • SMDF
    see all
  • Function

    Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development.
  • Tissue specificity

    Type I isoforms are the predominant forms expressed in the endocardium. Isoform alpha is expressed in breast, ovary, testis, prostate, heart, skeletal muscle, lung, placenta liver, kidney, salivary gland, small intestine and brain, but not in uterus, stomach, pancreas, and spleen. Isoform 3 is the predominant form in mesenchymal cells and in non-neuronal organs, whereas isoform 6 is the major neuronal form. Isoform 8 is expressed in spinal cord and brain. Isoform 9 is the major form in skeletal muscle cells; in the nervous system it is expressed in spinal cord and brain. Also detected in adult heart, placenta, lung, liver, kidney, and pancreas. Isoform 10 is expressed in nervous system: spinal cord motor neurons, dorsal root ganglion neurons, and brain. Predominant isoform expressed in sensory and motor neurons. Not detected in adult heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Not expressed in fetal lung, liver and kidney. Type IV isoforms are brain-specific.
  • Involvement in disease

    A chromosomal aberration involving NRG1 produces gamma-heregulin. Translocation t(8;11) with TENM4. The translocation fuses the 5'-end of TENM4 to NRG1 (isoform 8). The product of this translocation was first thought to be an alternatively spliced isoform. Gamma-heregulin is a soluble activating ligand for the ERBB2-ERBB3 receptor complex and acts as an autocrine growth factor in a specific breast cancer cell line (MDA-MB-175). Not detected in breast carcinoma samples, including ductal, lobular, medullary, and mucinous histological types, neither in other breast cancer cell lines.
  • Sequence similarities

    Belongs to the neuregulin family.
    Contains 1 EGF-like domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Developmental stage

    Detectable at early embryonic ages. Isoform 10 is highly expressed in developing spinal motor neurons and in developing cranial nerve nuclei. Expression is maintained only in both adult motor neurons and dorsal root ganglion neurons. Type IV isoforms are expressed in fetal brain.
  • Domain

    The cytoplasmic domain may be involved in the regulation of trafficking and proteolytic processing. Regulation of the proteolytic processing involves initial intracellular domain dimerization.
    ERBB receptor binding is elicited entirely by the EGF-like domain.
  • Post-translational
    modifications

    Proteolytic cleavage close to the plasma membrane on the external face leads to the release of the soluble growth factor form.
    N- and O-glycosylated. Extensive glycosylation precedes the proteolytic cleavage.
  • Cellular localization

    Secreted; Cell membrane. Does not seem to be active; Membrane. May possess an internal uncleaved signal sequence; Nucleus. May be nuclear and Secreted. Has a signal peptide.
  • Information by UniProt

Images

  • 1 µg ab222366 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

    ab222366 has a predicted weight of 7.6 kDa.

References

ab222366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up