Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRC DACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQ DYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEF GEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
    • Amino acids
      1 to 189
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MZB1
    • Caspase 2 binding protein
    • FLJ32987
    • HSPC190
    • Marginal zone B and B1 cell specific protein
    • MEDA 7
    • Mesenteric estrogen dependent adipose 7
    • Mesenteric oestrogen dependent adipose gene 7
    • MGC29506
    • PACAP
    • pERp1
    • Plasma cell-induced ER protein 1
    • Plasma cell-induced resident endoplasmic reticulum protein
    • Plasma cell-induced resident ER protein
    • Proapoptotic caspase adapter protein
    see all
  • Relevance
    Proapoptotic Caspase Adaptor Protein associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity By similarity. Isoform 2 may be involved in regulation of apoptosis.
  • Cellular localization
    Isoform 1: Endoplasmic reticulum Isoform 2: Cytoplasm. Note: Diffuse granular localization in the cytoplasm surrounding the nucleus.

Images

  • ab162468 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up