Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDM IVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYN VAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
    • Molecular weight

      15 kDa
    • Amino acids

      1 to 140

Associated products

Specifications

Our Abpromise guarantee covers the use of ab185845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.24% Tris, 0.88% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution

General Info

  • Alternative names

    • D3S1319E
    • PFL
    • PFN 2
    • Pfn2
    • PROF2_HUMAN
    • Profilin II
    • Profilin-2
    • Profilin2
    • ProfilinII
    see all
  • Function

    Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
  • Tissue specificity

    Highly expressed in brain, skeletal muscle and kidney and less strongly in heart, placenta, lung and liver.
  • Sequence similarities

    Belongs to the profilin family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

References

ab185845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up