Description

  • Product name

    Recombinant human Prolyl Endopeptidase protein
    See all Prolyl Endopeptidase proteins and peptides
  • Biological activity

    Specific Activity: ≥ 12 pmol/min/µg. Assay condition: 50 mM Tris (pH 7.5), 100 µg BSA, 20 µM substrate and 500 ng Prolyl Endopeptidase protein at room temperature for 30 min.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVE AQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGL QNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFAYGLS ASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQD GKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDG RYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVT NEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACV RSNFLVLCYLHDVKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEI FYQFTSFLSPGIIYHCDLTKEELEPRVFREVTVKGIDASDYQTVQIFYPS KDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLIFVRH MGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTS PKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHA WTTDYGCSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRV VPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVS DMFAFIARCLNVDWIP
    • Predicted molecular weight

      82 kDa
    • Amino acids

      2 to 710

Specifications

Our Abpromise guarantee covers the use of ab80376 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0462% DTT, 0.395% Tris HCl, 0.05% Tween, 30% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • dJ355L5.1 (prolyl endopeptidase)
    • HGNC:9358
    • MGC16060
    • OTTHUMP00000040498
    • PE
    • PEP
    • Post proline cleaving enzyme
    • Post-proline cleaving enzyme
    • PPCE_HUMAN
    • Prep
    • Prolyl endopeptidase
    • Prolyl oligopeptidase
    see all
  • Function

    Cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long.
  • Sequence similarities

    Belongs to the peptidase S9A family.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • Lane 1: ab80376 on 10% SDS-PAGE, Coomassie staining, 4µg.
    Lane 2: Protein marker.

References

ab80376 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer



Assay condition: 50 mM Tris (pH 7.5), 0.1% BSA, 20 uM substrate (A-P-AMC), and 500 ng ab80376 at room temperature for 30 min.

I hope this is helpful. Please feel free to contact me again with any further questions.

Read More

Answer


We don’t think POP can cleave BSA. See below for the answer. Some information taken from references.

In humans prolyl endopeptidase is encoded by the PREP gene.[5][6] The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Only short protein residues are able to enter the active site of prolyl endopeptidase due to the distinct beta-propeller region that acts as a gating filter mechanism. [7][8] Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides.There's an indication that altered PREP activity is associated with autism spectrum disorders and various psychological diseases such as schizophrenia, mania and clinical depression.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up