Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMARPVKEPRGLSAASPPLAETGAPRRF RRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQL LRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPV PAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADS EGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLP P
    • Molecular weight
      27 kDa including tags
    • Amino acids
      34 to 260
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NCBI Accession No.: NP_037403

Specifications

Our Abpromise guarantee covers the use of ab174456 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • b-LEN
    • b-PEN-LEN
    • b-SAAS
    • Big LEN
    • granin like neuroendocrine peptide
    • l-LEN
    • l-SAAS
    • N-proSAAS
    • OTTHUMP00000032426
    • PCSK1_HUMAN
    • Pcsk1n
    • pro-SAAS
    • Proprotein convertase 1 inhibitor
    • Proprotein convertase subtilisin/kexin type 1 inhibitor
    • PROSAAS
    • SAAS
    • SAAS CT(1-49)
    • SAAS CT(25-40)
    see all
  • Function
    May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activity in the endoplasmic reticulum and Golgi. It reduces the activity of the 84 kDa form but not the autocatalytically derived 66 kDa form of PCSK1. Subsequent processing of proSAAS may eliminate the inhibition. Slows down convertase-mediated processing of proopiomelanocortin and proenkephalin. May control the intracellular timing of PCSK1 rather than its total level of activity. The function of the processed secreted peptides is not known.
  • Tissue specificity
    Expressed in brain and pancreas.
  • Domain
    ProSAAS(1-180) increases secretion of enzymatically inactive PCSK1.
    The C-terminal inhibitory domain is involved in inhibtion of PCSK1. It corresponds to the probable processing intermediate Big PEN-LEN, binds to PCSK1 in vitro and contains the hexapeptide L-L-R-V-K-R, which, as a synthetic peptide, is sufficient for PCSK1 inhibition.
  • Post-translational
    modifications
    Proteolytically cleaved in the Golgi.
    O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization
    Secreted. Golgi apparatus > trans-Golgi network. A N-terminal processed peptide, probably Big SAAS or Little SAAS, is accumulated in cytoplasmic protein tau deposits in frontotemporal dementia and parkinsonism linked to chromosome 17 (Pick disease), Alzheimer disease and amyotrophic lateral sclerosis-parkinsonism/dementia complex 1.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174456 (3 µg)

References

ab174456 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174456.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up