Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GSHMPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLP FGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDD FMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVT WADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIK RRPQTKL
    • Molecular weight
      23 kDa
    • Amino acids
      2 to 199

Specifications

Our Abpromise guarantee covers the use of ab172856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab172856 is 0.2 µM filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 1.17% Sodium chloride, 0.24% Tris

General Info

  • Alternative names
    • Cerebrin 28
    • Glutathione dependent PGD synthetase
    • Glutathione S-transferase
    • Glutathione-dependent PGD synthase
    • Glutathione-requiring prostaglandin D synthase
    • GST class-sigma
    • H PGDS
    • H-PGDS
    • Haematopoietic prostaglandin D synthase
    • Haematopoietic prostaglandin D2 synthase
    • Hematopoietic prostaglandin D synthase
    • Hpgds
    • HPGDS_HUMAN
    • Prostaglandin D synthase
    • Prostaglandin D2 synthase hematopoietic
    • Prostaglandin H2 D isomerase
    • Prostaglandin-H2 D-isomerase
    • PTGDS2
    see all
  • Function
    Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide.
  • Tissue specificity
    Expressed in a number of megakaryocytic cell lines but not in platelets. Highly expressed in adipose tissue, macrophages and placenta. Also expressed at lower levels in lung, heart, lymph nodes, appendix, bone marrow and fetal liver.
  • Sequence similarities
    Belongs to the GST superfamily. Sigma family.
    Contains 1 GST C-terminal domain.
    Contains 1 GST N-terminal domain.
  • Developmental stage
    Highest levels in immature megakaryocytic cells. Disappears after final differentiation to platelets.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab172856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up