Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSN LLALALLAQAAGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYT AGRAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTRPLLHAARVS VARARLALAAVAAVALAVALLPLARVGRYELQYPGTWCFIGLGPPGGWRQ ALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRRPPPASGPDSR RRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWV YILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLS HF
    • Amino acids
      1 to 402
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159273 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EP1
    • PGE receptor EP1 subtype
    • PGE2 receptor EP1 subtype
    • Prostaglandin E receptor 1 subtype EP1
    • Prostaglandin E receptor 1 subtype EP1 42kDa
    • Prostaglandin E2 receptor EP1 subtype
    • Prostanoid EP1 receptor
    • PTGER1
    see all
  • Relevance
    PTGER1 is a subtype 1 receptor for prostaglandin E2 (PGE2). This receptor is coupled to the phosphatidylinositol-calcium second messenger system by G(q) proteins. PTGER1 may be an important modulator of renal function and is implicated in the smooth muscle contractile response to PGE2 in various tissues.
  • Cellular localization
    Cell Membrane; multi-pass membrane protein.

Images

  • ab159273 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159273 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159273.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up