Description

  • Product name

    Recombinant Human Prostaglandin E Receptor EP2/PTGER2 protein
    See all Prostaglandin E Receptor EP2/PTGER2 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRW RGDVGCSAGRRSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLV ALAPESRACTYFAFAMTFFSLATMLMLFAMALERYLSIGHPYFYQRRVSR SGGLAVLPVIYAVSLLFCSLPLLDYGQYVQYCPGTWCFIRHGRTAYLQLY ATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGSGRGGPGARRR GERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQS DASKQADL
    • Predicted molecular weight

      66 kDa including tags
    • Amino acids

      1 to 358

Specifications

Our Abpromise guarantee covers the use of ab132957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

     This product was previously labelled as Prostaglandin E Receptor EP2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EP2
    • PE2R2_HUMAN
    • PGE receptor EP2 subtype
    • PGE2 receptor EP2 subtype
    • Prostaglandin E receptor 2 EP2 subtype
    • Prostaglandin E receptor 2 subtype EP2
    • Prostaglandin E receptor 2 subtype EP2 53kDa
    • Prostaglandin E2 receptor
    • Prostaglandin E2 receptor EP2 subtype
    • Prostanoid EP2 receptor
    • Ptger2
    see all
  • Function

    Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle.
  • Tissue specificity

    Placenta and lung.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132957 stained with Coomassie Blue.

References

ab132957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up